PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_37971
Common NameKK1_038729
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NAC
Protein Properties Length: 364aa    MW: 40354.2 Da    PI: 8.8874
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_37971genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.1e-53151421128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLkkk+++ +l++  +i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vl++ 
  C.cajan_37971  15 LPPGFRFHPTDEELVVHYLKKKAASAPLPV-AIIAEVDLYKFDPWELPAKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLTSg 109
                    79****************************.88***************988899***************************************997 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg+kk Lvfy g+ p+g kt+W+mheyrl
  C.cajan_37971 110 GTQKVGVKKALVFYGGKPPRGIKTNWIMHEYRL 142
                    7788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-657176IPR003441NAC domain
PROSITE profilePS5100562.03315176IPR003441NAC domain
PfamPF023653.7E-2816142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009753Biological Processresponse to jasmonic acid
GO:0045995Biological Processregulation of embryonic development
GO:0048317Biological Processseed morphogenesis
GO:0080060Biological Processintegument development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MESTDSSTGS QQPNLPPGFR FHPTDEELVV HYLKKKAASA PLPVAIIAEV DLYKFDPWEL  60
PAKATFGEQE WYFFSPRDRK YPNGARPNRA ATSGYWKATG TDKPVLTSGG TQKVGVKKAL  120
VFYGGKPPRG IKTNWIMHEY RLADNKPNNR PPGCDLGNKK NSLRLDDWVL CRIYKKSNTH  180
RSPMEHERED SMEDMIGGVP PSMNLSHMNA RFHLSKMSTT GYNSALLEND QNLLEGMMMN  240
TSTTTPGAMS SQLGGSNSKP ELSFVPTMTH SSNTSKRTLS SLYWNDEDVA GTSSSNKRFN  300
LESGDNNHGS VVRTDQENGT ANSIATLLNQ LPQTPSLHQQ SMLGSLGDGL LRTTYQIPGM  360
NWYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-761417814170Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00361DAPTransfer from AT3G15510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6619161e-178EU661916.1 Glycine max NAC domain protein (NAC16) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149615.10.0hypothetical protein PHAVU_005G084600g
SwissprotQ9LD441e-127NAC56_ARATH; NAC transcription factor 56
TrEMBLA0A151RBC40.0A0A151RBC4_CAJCA; NAC domain-containing protein 18
STRINGGLYMA12G34990.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15510.11e-128NAC domain containing protein 2